RAB4A_MOUSE P56371
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56371
Recommended name：Ras-related protein Rab-4A
EC number：
Alternative names：
Cleaved into：
GeneID：19341
Gene names (primary )：Rab4a
Gene names (synonym )：Rab4
Gene names (ORF )：
Length：218
Mass：24409
Sequence：MAQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVLILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFMQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRTQAPSAQECGC
Tissue specificity：Expressed in the central nervous system, including cortex, cerebellum, midbrain and spinal cord, and in the kidney, lung, liver and spleen. {ECO:0000269|PubMed:20098723}.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Rab family