PO4F1_RAT P20266
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P20266
Recommended name：POU domain, class 4, transcription factor 1
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Pou4f1
Gene names (synonym )：Brn-3, Brn3, Brn3a
Gene names (ORF )：
Length：420
Mass：43,275
Sequence：MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAGGGGAPTRPRGAGGPGGGGGPGGGGPGVAGRRRGPGGGGGGPGGGLLGXSAHPHPHMHGXGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY
Tissue specificity：Detected in brain, spinal cord and dorsal root ganglion (PubMed:2739723, PubMed:8835784). Isoform 2 is detected in brain, spinal cord, dorsal root ganglion and spleen (PubMed:8835784). 2 s
Induction：
Developmental stage：
Protein families：POU transcription factor family