RAB19_MOUSE P35294
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35294
Recommended name：Ras-related protein Rab-19
EC number：
Alternative names：
Cleaved into：
GeneID：19331
Gene names (primary )：Rab19
Gene names (synonym )：
Gene names (ORF )：
Length：217
Mass：24398
Sequence：MQFSSSSRTSDENVDYLFKVILIGDSNVGKTCVVQHFKSGVYSESQQNTIGVDFTVRSLEIDGKKVKMQVWDTAGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESVPHWIHEIEKYGAANLVIMLIGNKSDLWEKRHVLFEDACTLAEKHGLLAVLETSAKESRNIDEVFVLMAKELIARNSLHLYGESAQQGLSQDSSPVLVAQVPNESTRCTC
Tissue specificity：Expressed in a tissue-specific manner. Detected at high levels in intestine, lung and spleen, and at a lower level in kidney.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Rab family