SPIC_HUMAN Q8N5J4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N5J4
Recommended name：Transcription factor Spi-C
EC number：
Alternative names：
Cleaved into：
GeneID：121599
Gene names (primary )：SPIC
Gene names (synonym )：
Gene names (ORF )：
Length：248
Mass：29180
Sequence：MTCVEQDKLGQAFEDAFEVLRQHSTGDLQYSPDYRNYLALINHRPHVKGNSSCYGVLPTEEPVYNWRTVINSAADFYFEGNIHQSLQNITENQLVQPTLLQQKGGKGRKKLRLFEYLHESLYNPEMASCIQWVDKTKGIFQFVSKNKEKLAELWGKRKGNRKTMTYQKMARALRNYGRSGEITKIRRKLTYQFSEAILQRLSPSYFLGKEIFYSQCVQPDQEYLSLNNWNANYNYTYANYHELNHHDC
Tissue specificity：Preferentially detected in fetal and adult spleen, lymph nodes and at lower levels in bone marrow and fetal liver. {ECO:0000269|PubMed:12459275}.
Induction：
Developmental stage：
Protein families：ETS family