RTBDN_MOUSE Q8QZY4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8QZY4
Recommended name：Retbindin
EC number：
Alternative names：
Cleaved into：
GeneID：234542
Gene names (primary )：Rtbdn
Gene names (synonym )：
Gene names (ORF )：
Length：247
Mass：26559
Sequence：MAHEGHSQHSGLVWALRPILAWIFLVACGWSHPLQTRSWGHPGLAAKVRTGQLQPAGHPQSSVLPSYPRIQVPGSQTPPVPVPCCTAEIDRPESLLESCGAPSPECEFFLGQLQGALRDRFHPQLFGARPVQPLCPELCQIWFTTCQADFICGPTWLQSSGERGCEPSCRTYGQTFANATDLCHSVLGHVLRVAAPGSSHCLNVSISSPGARRRPRAWISNVVGSGSGSGSGDSPEPMFGFQYVSLP
Tissue specificity：Expressed in the peripheral retina where it localizes to the inter-photoreceptor matrix (at protein level). May be produced by rod photoreceptors (at protein level). {ECO:0000269|PubMed:25542898}.
Induction：
Developmental stage：
Protein families：Folate receptor family