S13A2_RAT P70545
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70545
Recommended name：Solute carrier family 13 member 2
EC number：
Alternative names：
Cleaved into：
GeneID：65202
Gene names (primary )：Slc13a2
Gene names (synonym )：Nadc1, Sdct1 1 Publication
Gene names (ORF )：
Length：587
Mass：64,143
Sequence：MATCWPALWAYRFYLIVLCLPIFLLPLPLIVQTKEAYCAYSIILMALLWCTEALPLAVTALFPIVLFPLMGIMDASEVCIEYFKDTNILFVGGLMVAIAVEHWNLHKRIALQVLLIIGVRPALLLLGFMLVTAFLSMWISNTATTAMMVPIGHAVLEQLQGSKKDVEGGNNNPTFELQEECPQKEVTKLDNGQPVSAPSEPRTQKTQEHHRFSQGLSLCICYSASIGGIATLTGTTPNLVLQGQVNSLFPQNGNVVNFASWFGFAFPTMIILLLLAWLWLQVLFLGVNFRKNFGFGEGEEERKQAAFQVIKTQYRLLGPMSFAEKTVTVLFVLLVVLWFTREPGFFPGWGDTVFANEKGQSMASDGTVAIFISLVMFIIPSKIPGLMQDPKKPGKLKAPPAILTWKTVNDKMPWNIVILLGGGFALAKGSEQSGLSEWLGDKLTPLQHIPPSATAVILCLLIAIFTECTSNVATTTLFLPILASMAQAICLHPLYVMLPCTLAASLAFMLPVATPPNAIVFSFGGLKVSDMARAGFLLNIIGVLAITLSINSWSIPIFKLDTFPSWAHSNTSQCLLNPSNSTVPGGL
Tissue specificity：Expressed in large and small intestine and in the kidney proximal tubules. 2 s
Induction：
Developmental stage：
Protein families：