DHI1_RAT P16232
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P16232
Recommended name：11-beta-hydroxysteroid dehydrogenase 1 2 Publications
EC number：EC:1.1.1.146
Alternative names：11-DH 1 Publication; 11-beta-HSD1 2 Publications
Cleaved into：
GeneID：
Gene names (primary )：Hsd11b1
Gene names (synonym )：Hsd11
Gene names (ORF )：
Length：288
Mass：31,883
Sequence：MKKYLLPVLVLCLGYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMAFAERFVVEAGKLLGGLDMLILNHITQTTMSLFHDDIHSVRRSMEVNFLSYVVLSTAALPMLKQSNGSIAIISSMAGKMTQPLIASYSASKFALDGFFSTIRKEHLMTKVNVSITLCVLGFIDTETALKETSGIILSQAAPKEECALEIIKGTVLRKDEVYYDKSSWTPLLLGNPGRRIMEFLSLRSYNRDLFVSN
Tissue specificity：Liver, kidney, lung and testis (PubMed:2808402). Brain (PubMed:2387261). Expressed in liver (at protein level) (PubMed:21453287). 3 s
Induction：
Developmental stage：Expression of both isoforms is found in 1 week-old rats. Expression increases exponentially up to 4 weeks but after this time there is no further increase up to 16 weeks.
Protein families：