IL27B_MOUSE O35228
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35228
Recommended name：Interleukin-27 subunit beta
EC number：
Alternative names：(IL-27 subunit beta) (IL-27B) (Epstein-Barr virus-induced gene 3 protein homolog)
Cleaved into：
GeneID：50498
Gene names (primary )：Ebi3
Gene names (synonym )：Il27b
Gene names (ORF )：
Length：228
Mass：25353
Sequence：MSKLLFLSLALWASRSPGYTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP
Tissue specificity：
Induction：
Developmental stage：
Protein families：Type I cytokine receptor family, Type 3 subfamily