UB2V1_MOUSE Q9CZY3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CZY3
Recommended name：Ubiquitin-conjugating enzyme E2 variant 1
EC number：
Alternative names：(UEV-1) (CROC-1)
Cleaved into：
GeneID：66589
Gene names (primary )：Ube2v1
Gene names (synonym )：Croc1
Gene names (ORF )：
Length：147
Mass：16355
Sequence：MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPSVRFVTRVNMSGVSSSNGVVDPRATAVLAKWQNSHSIKVILQELRRLMMSKENMKLPQPPEGQCYSN
Tissue specificity：Ubiquitous. Highly expressed in heart, brain, liver, skeletal msucle, kidney and testis. Detected at lower levels in lung and spleen. {ECO:0000269|PubMed:11406273}.
Induction：
Developmental stage：
Protein families：Ubiquitin-conjugating enzyme family