FBX50_HUMAN Q6ZVX7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6ZVX7
Recommended name：F-box only protein 50
EC number：
Alternative names：(NCC receptor protein 1 homolog) (NCCRP-1) (Non-specific cytotoxic cell receptor protein 1 homolog)
Cleaved into：
GeneID：342897
Gene names (primary )：NCCRP1
Gene names (synonym )：FBXO50
Gene names (ORF )：
Length：275
Mass：30847
Sequence：MEEVREGHALGGGMEADGPASLQELPPSPRSPSPPPSPPPLPSPPSLPSPAAPEAPELPEPAQPSEAHARQLLLEEWGPLSGGLELPQRLTWKLLLLRRPLYRNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLLAEGLWEELLDDEQPAITVMDWFEDSRLDACVYELHVWLLAADRRTVIAQHHVAPRTSGRGPPGRWVQVSHVFRHYGPGVRFIHFLHKAKNRMEPGGLRRTRVTDSSVSVQLRE
Tissue specificity：Expressed in the esophagus, oral cavity, skin, tongue and reproductive organs. {ECO:0000269|PubMed:22087255}.
Induction：
Developmental stage：
Protein families：