GKN3_MOUSE Q9D0T7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D0T7
Recommended name：Gastrokine-3
EC number：
Alternative names：
Cleaved into：
GeneID：68888
Gene names (primary )：Gkn3
Gene names (synonym )：
Gene names (ORF )：
Length：191
Mass：20772
Sequence：MPLHSLERDNMRRLIAPSILVTVFLVPALALTNTSDSYPLDGSVGTQTIHVDALRGVVSIRDNSVQSEWDGVMDYKNDLLAAKLFSKMACVLAKMDPAAFPSLDDITQALGKQASGHYPPTRGLTYTVLPSRIKNLAQYGVPIKDLCRAVPTYFARQQKEGTALTMDPDSCSELQLLSFMGLSICGEIPGL
Tissue specificity：Expressed in stomach. Present in mucus cells at the base of antral glands, and Brunner glands of the duodenum. Present at lower levels in the mucus neck cell region of the fundus (at protein level). {ECO:0000269|PubMed:20138039}.
Induction：
Developmental stage：
Protein families：Gastrokine family