KCIP2_MOUSE Q9JJ69
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JJ69
Recommended name：Kv channel-interacting protein 2
EC number：
Alternative names：(KChIP2) (A-type potassium channel modulatory protein 2) (Potassium channel-interacting protein 2)
Cleaved into：
GeneID：80906
Gene names (primary )：Kcnip2
Gene names (synonym )：Kchip2
Gene names (ORF )：
Length：270
Mass：30946
Sequence：MRGQGRKESLSDSRDLDGSYDQLTGHPPGPSKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRPLDPDSVEDEFELSTVCHRPEGLEQLQEQTKFTRRELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSNYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTIDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQQDENIMRSMQLFDNVI
Tissue specificity：Detected in brain (at protein level) (PubMed:23713033). Expressed in brain. Highly expressed in layer IV of the cerebral cortex and in striatum and hippocampus, but expressed at low levels in cerebellum. Also expressed in heart. According to PubMed:11747815 expressed in heart at much higher levels than in brain with a preferential expression in the myocardium. {ECO:0000269|PubMed:11263977, ECO:0000269|PubMed:11747815, ECO:0000269|PubMed:15363885, ECO:0000269|PubMed:23713033}.
Induction：
Developmental stage：
Protein families：Recoverin family