CSEN4_MOUSE P0C092
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0C092
Recommended name：Calsenilin isoform 4
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Kcnip3
Gene names (synonym )：Csen Dream Kchip3
Gene names (ORF )：
Length：89
Mass：9471
Sequence：MRQLPAGPSSLACSGCKAGRLVTVPFSSRDAEDQGSREGIGWQPPGRSWAHTTEQEGKHQVAKATVHPPGPDALLLNQVDPVQCCPTRL
Tissue specificity：Isoform 1 or isoform 4 (T+ forms) are expressed at equal levels with isoform 2 or isoform 3 (T- forms) in brain. {ECO:0000269|PubMed:11161465}.
Induction：
Developmental stage：
Protein families：