FABPI_RAT P02693
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P02693
Recommended name：Fatty acid-binding protein, intestinal
EC number：
Alternative names：
Cleaved into：
GeneID：25598
Gene names (primary )：Fabp2
Gene names (synonym )：Fabpi
Gene names (ORF )：
Length：132
Mass：15,124
Sequence：MAFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
Tissue specificity：Expressed in the small intestine. Expression in the mucosal cells of the ileum extends from the midvillar region to the villus tips. 1
Induction：
Developmental stage：By peptide YY. 1
Protein families：calycin superfamily