YPEL4_HUMAN Q96NS1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96NS1
Recommended name：Protein yippee-like 4
EC number：
Alternative names：
Cleaved into：
GeneID：219539
Gene names (primary )：YPEL4
Gene names (synonym )：
Gene names (ORF )：
Length：127
Mass：14301
Sequence：MPSCDPGPGPACLPTKTFRSYLPRCHRTYSCVHCRAHLAKHDELISKSFQGSHGRAYLFNSVVNVGCGPAEQRLLLTGLHSVADIFCESCKTTLGWKYEQAFETSQKYKEGKYIIEMSHMVKDNGWD
Tissue specificity：Widely expressed. Detected adult brain, lung, colon, small intestine and ovary, and in fetal brain, lung, liver and spleen. {ECO:0000269|PubMed:15556292}.
Induction：
Developmental stage：
Protein families：Yippee family