MK01_RAT P63086
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63086
Recommended name：Mitogen-activated protein kinase 1 Curated
EC number：EC:2.7.11.24
Alternative names：MAP kinase 1; MAPK 1
Cleaved into：
GeneID：116590
Gene names (primary )：Mapk1
Gene names (synonym )：Erk2, Mapk, Prkm1
Gene names (ORF )：
Length：358
Mass：41,276
Sequence：MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Tissue specificity：Highest levels within the nervous system, expressed in different tissues, mostly in muscle, thymus and heart.
Induction：
Developmental stage：Increased expression during development.
Protein families：protein kinase superfamily