CPS4L_HUMAN   A6NMK7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A6NMK7

Recommended name:Putative cleavage and polyadenylation specificity factor subunit 4-like protein

EC number:

Alternative names:

Cleaved into:

GeneID:642843

Gene names  (primary ):CPSF4L

Gene names  (synonym ):

Gene names  (ORF ):

Length:179

Mass:20727

Sequence:MQEVIAGLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDRGEKMVVCKHWLRGLCKKGDHCKFLHQYDLTRMPECYFYSKFGDCSNKECSFLHVKPAFKSQDCPWYDQGFCKDGPLCKYRHVPRIMCLNYLVGFCPEGPKCQFAQKIREFKLLPGSKI

Tissue specificity:

Induction:

Developmental stage:

Protein families:CPSF4/YTH1 family


   💬 WhatsApp