RN151_MOUSE Q9CQ29
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQ29
Recommended name：RING finger protein 151
EC number：
Alternative names：
Cleaved into：
GeneID：67504
Gene names (primary )：Rnf151
Gene names (synonym )：
Gene names (ORF )：
Length：239
Mass：27175
Sequence：MSGGYDLNLFASPPDCKFLCSVCHGVLKRPTRLPCSHIFCKKCIFRWLARQNTCPCCRKEVTRRKMVEVNKLRKTIGRLQVKCKNAAAGCLDTHPLAHRKEHQDSCPFELMACPNEGCTVQVLRGVLDEHRQHCQQNGQQRCPLGCGSTLAALEGEHHNCYRELRDAWVQRHERNRTLLLGLLGRVRRVHLTTSIIHQQLAQLSNFLEDDDNLLLNAQVQETEVTPEAEMRGTQGQSVL
Tissue specificity：Expressed in testis. Expressed in round spermatids of the stages VII-VIII semniniferous tubules. Expressed in elongating spermatids of stages VIII-IX seminiferous tubules (at protein level). {ECO:0000269|PubMed:17577571}.
Induction：
Developmental stage：
Protein families：