GPR12_MOUSE P35412
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35412
Recommended name：G-protein coupled receptor 12
EC number：
Alternative names：(GPCR01)
Cleaved into：
GeneID：14738
Gene names (primary )：Gpr12
Gene names (synonym )：Gpcr12
Gene names (ORF )：
Length：334
Mass：36589
Sequence：MNEDPKVNLSGLPRDCIDAGAPENISAAVPSQGSVAESEPELVVNPWDIVLCSSGTLICCENAVVVLIIFHSPSLRAPMFLLIGSLALADLLAGLGLIINFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSISFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLALILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLSQRARSPSDV
Tissue specificity：Expressed predominantly in the forebrain and a lesser extent in the hindbrain. Lower expression in the liver.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family