KPCZ_RAT P09217
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P09217
Recommended name：Protein kinase C zeta type
EC number：EC:2.7.11.13
Alternative names：nPKC-zeta
Cleaved into：
GeneID：
Gene names (primary )：Prkcz
Gene names (synonym )：Pkcz
Gene names (ORF )：
Length：592
Mass：67,733
Sequence：MPSRTDPKMDRSGGRVRLKAHYGGDILITSVDPTTTFQDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLACQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHVLVPLTCRRHMDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV
Tissue specificity：Isoform 1: In brain, expressed in hippocampus, neocortex and cerebellum (at protein level) (PubMed:12857744, PubMed:8378304). Also expressed in lung, liver, kidney, testis and to a lesser extent in pancreas, intestine and skin (at protein level) (PubMed:12857744). Isoform 2: Specifically expressed in brain where it localizes to the hippocampus, neocortex and cerebellum (at protein level) (PubMed:12857744, PubMed:27498875, PubMed:8378304). 3 s
Induction：
Developmental stage：Induced during synaptic long term potentiation. 3 s
Protein families：