NB5R3_RAT P20070
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P20070
Recommended name：NADH-cytochrome b5 reductase 3 Curated
EC number：EC:1.6.2.2
Alternative names：B5R; Cytochrome b5 reductase
Cleaved into：
GeneID：
Gene names (primary )：Cyb5r3
Gene names (synonym )：Dia1
Gene names (ORF )：
Length：301
Mass：34,175
Sequence：MGAQLSTLSRVVLSPVWFVYSLFMKLFQRSSPAITLENPDIKYPLRLIDKEIISHDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMNIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSSRFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPPPGEETLILMCGPPPMIQFACLPNLERVGHPKERCFTF
Tissue specificity：Ubiquitously expressed. 2 s
Induction：Expressed only in erythroid tissues, reticulocytes and liver. 2 Publications
Developmental stage：Ubiquitously expressed. 1
Protein families：