ZC3HE_MOUSE Q8BJ05
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BJ05
Recommended name：Zinc finger CCCH domain-containing protein 14
EC number：
Alternative names：
Cleaved into：
GeneID：75553
Gene names (primary )：Zc3h14
Gene names (synonym )：
Gene names (ORF )：
Length：735
Mass：82409
Sequence：MEIGTEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTIRFTVWLHGVLDKLRSVTTEPSSLKSPDASIFDSHVPSNKSSFSRGDERRHEAAVPPLAVSSSRPEKRDSRVSTSSQEQKSTNVRHSYDDGASTRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADTGTHLNRLQLHPQQSSAHAAKQLDVQSSQVSEAGRLCEPPVLSSVEDTYSPFFRNNLDKMSIEDENFRKRKLPVVSSVVKVKRFSHDGEEEEEDEDYGTRIGSLSSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKTTNYSAVPQKQTLPVAPRTRTSQEELLAEMVQGQNRAPRISPPVKEEEAKGDNTGKSQGTQQRQLLSRLQIDPVMVETMEMSQDYYDMESMVHADTRSFILKKPKLSEEIVVTPNQDSGMKTADALRVLSGHLMQTRDLVQPDKPASPKFIVTLDGVPSPPGYMSDQEEEMCFEGMKPVNQTSASNKGLRGLLHPQQLHLLSRQLEDPDGSFSNAEMTDLSVAQKPEKLLERCKYWPACKNGDECVYHHPISPCKAFPNCKFAEKCLFVHPNCKYDTKCTKADCPFTHMSRRASILTPKPVSSPAPSSNGQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTITVPPRHALKWIRPQSSE
Tissue specificity：Expressed in hippocampal pyramidal neurons (at protein level) (PubMed:21734151).Expressed in kidney, liver, muscle, heart brain and testes (PubMed:19303045). Expressed in hippocampal pyramidal neurons (PubMed:21734151). {ECO:0000269|PubMed:21734151}.
Induction：
Developmental stage：
Protein families：ZC3H14 family