M4A4D_MOUSE Q99N05
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99N05
Recommended name：Membrane-spanning 4-domains subfamily A member 4D
EC number：
Alternative names：
Cleaved into：
GeneID：66607
Gene names (primary )：Ms4a4d
Gene names (synonym )：
Gene names (ORF )：
Length：225
Mass：23859
Sequence：MQGLAQTTMAVVPGGAPPSENSVIKSQMWNKNKEKFLKGEPKVLGAIQVMIAFINFSLGIIIILNRVSERFMSVLLLAPFWGSIMFIFSGSLSIAAGVKPTKAMIISSLSVNTISSVLAVAASIIGVISVISGVFRQFRSQPAIASLDVLMTILNMLEFCIAVSVSAFGCKASCCNSSEVLVVLPSNSAVTVTAPPMILQPLPPSECQGKNVPENLYRNQPGEIV
Tissue specificity：Expressed in thymus, spleen, peripheral lymph node, liver, kidney, heart, colon, lung, and testes.
Induction：
Developmental stage：
Protein families：MS4A family