IF4E_RAT P63074
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63074
Recommended name：Eukaryotic translation initiation factor 4E
EC number：
Alternative names：eIF-4F 25 kDa subunit mRNA cap-binding protein
Cleaved into：
GeneID：117045
Gene names (primary )：Eif4e
Gene names (synonym )：
Gene names (ORF )：
Length：217
Mass：25,053
Sequence：MATVEPETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
Tissue specificity：Very high levels in post-meiotic testicular germ cells of rats of reproductive age. 1
Induction：
Developmental stage：
Protein families：