VAMP1_MOUSE Q62442
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62442
Recommended name：Vesicle-associated membrane protein 1
EC number：
Alternative names：(VAMP-1) (Synaptobrevin-1)
Cleaved into：
GeneID：22317
Gene names (primary )：Vamp1
Gene names (synonym )：Syb1
Gene names (ORF )：
Length：118
Mass：12890
Sequence：MSAPAQPPAEGTEGAAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT
Tissue specificity：Highly expressed in the zona incerta and rostral periolivary region of the brain. Other neuroanatomical regions show negligible expression. Expressed in the retina, expression observed in the outer segments of the photoreceptors, in the outer and inner plexiform layers, and in a subset of ganglion cells. {ECO:0000269|PubMed:17102983}.
Induction：
Developmental stage：
Protein families：Synaptobrevin family