IPP_MOUSE P28575
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P28575
Recommended name：Actin-binding protein IPP
EC number：
Alternative names：(Intracisternal A particle-promoted polypeptide) (IPP) (Murine IAP-promoted placenta-expressed protein) (Protein MIPP)
Cleaved into：
GeneID：16351
Gene names (primary )：Ipp
Gene names (synonym )：Mipp
Gene names (ORF )：
Length：584
Mass：65216
Sequence：MSKEECPKAADNSFSSDKHAQLILAQMNKMRSGQHFCDVQLQVGKETFQVHRLVLAASSPYFAALFTGGMKESSKDVVQILGVEAGIFQLLLDFIYTGVVNIAVTNVQELIVAADMLQLTEVVNLCCDFLKGQIDPQNCIGLFQFSEQIACHDLLEFTENYIHVHFLEVHTGEEFLGLTKDQLIKILRSEELSIEDEYQVFLAAMQWILKDLGKRRKHVVEVLDPVRFPLLPSQRLLKYIEGVSDFNLRVALQTLLKEYCEVCKSPKENKFCSFLQTSKVRPRKKARKYLYAVGGYTRLQGGRWSDSRALSCVERFDTFSQYWTTVSSLHQARCGLGVAVVGGMVYAIGGEKDSMIFDCTECYDPVTKQWTTVASMNHPRCGLGVCVCYGAIYALGGWVGAEIGNTIERFDPDENKWEVVGSMAVSRYYFGCCEMQGLIYAVGGISNEGLELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAALNDCIYAIGGWNETQDALHTVEKYSFEEEKWVEVASMKVPRAGMCAVTVNGLLYVSGGRSSSHDFLAPGTLDSVEVYNPHSDTWTEIGNMITSRCEGGVAVL
Tissue specificity：Expression seems confined to tissues derived from trophectoderm and primitive endoderm. {ECO:0000269|PubMed:1905535}.
Induction：
Developmental stage：
Protein families：