OLIG1_HUMAN Q8TAK6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8TAK6
Recommended name：Oligodendrocyte transcription factor 1
EC number：
Alternative names：(Oligo1) (Class B basic helix-loop-helix protein 6) (bHLHb6) (Class E basic helix-loop-helix protein 21) (bHLHe21)
Cleaved into：
GeneID：116448
Gene names (primary )：OLIG1
Gene names (synonym )：BHLHB6 BHLHE21
Gene names (ORF )：
Length：271
Mass：27905
Sequence：MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
Tissue specificity：Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable. {ECO:0000269|PubMed:11526205}.
Induction：
Developmental stage：
Protein families：