ARMX3_MOUSE Q8BHS6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BHS6
Recommended name：Armadillo repeat-containing X-linked protein 3
EC number：
Alternative names：
Cleaved into：
GeneID：71703
Gene names (primary )：Armcx3
Gene names (synonym )：Alex3
Gene names (ORF )：
Length：379
Mass：42620
Sequence：MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTVTSRLNSSVQLAGLRLLTNMTVTNEYQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKEYKEVILKLLIIFENINDNFKWEENEPAQNHFSEGSLFFFLKEFQVCADKVLGIESRHDFQVRVKVGKFVAKLTERMFPKSQE
Tissue specificity：Highly expressed in the developing neural tissues, neural crest derivatives and hind limbs. Also widely expressed in the adult nervous tissue, especially in the forebrain, including the cerebral cortex, hippocampus and thalamus. {ECO:0000269|PubMed:22569362}.
Induction：
Developmental stage：
Protein families：Eutherian X-chromosome-specific Armcx family