ZBT49_MOUSE Q8BXX2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BXX2
Recommended name：Zinc finger and BTB domain-containing protein 49
EC number：
Alternative names：(Zinc finger protein 509)
Cleaved into：
GeneID：75079
Gene names (primary )：Zbtb49
Gene names (synonym )：Zfp509 Znf509
Gene names (ORF )：
Length：756
Mass：83091
Sequence：MDPVAVHSCHLLQQLREQRIQGLLCDCMLVVRGVCFKAHKNVLAAFSQYFRSLFQNSSSQKNDVFHLDVTNVSGIGQILDFMYTSRLDLNQDNIQVMLDTAQCLQVQNVLNLCHTFLKSAPAAQLPGLPCAGGFSLQSVALDGTCAVSEHYPPPSLQECPVEGPQAKVPAEVNARAPSANFSRPTEVSKPDAAGGSCPELPCKQPNHYYKLRTLYSKQYYKQTACPSQVPATQQPLTRSASTDLAAADSQPPVEGRPAVLETPEHLPSTFVAPPVRNSGNDSEADPLSEPPAKQMRLKKAMHLKKLNFLKSQQSAECTSHPEPDNGLARREESAAKEDAVERAGSQTAEEKGRGELGPESSREEELPGAPASWEDPSQALQPQKQYACELCGKPFKHPSNLELHKRSHTGEKPFECNICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAASGDVQRHIIIHSGEKPHLCDTCGRGFSNFSNLKEHKKTHTADKVFTCDECGKSFNMQRKLVKHRVRHTGERPYSCPACGKCFGGSGDLRRHVRTHTGEKPYSCEVCSKCFTRSAVLRRHKRMHGRADARSPVVLGELSRPIEPSDLDRSQSSDSFSQDVSVTLMPVSVKLPVQPVESSVAGFDGHCSGSYCKLRSMLRPPGMSDQDRLSLEPSKLAKPPELQSQPQAYAYSDVEPSAGVEQPQADGMAVSRSSLATLDNHCTEPLGSRAPSVTYRNSEGQFFSSMTLWGLAMKTLQNEHELEQ
Tissue specificity：Widely expressed, with highest levels in white adipose tissue and kidney, intermediate levels in brain, liver and heart, and lowest levels in spleen, brown adipose tissue and muscle. {ECO:0000269|PubMed:25245946}.
Induction：
Developmental stage：
Protein families：Krueppel C2H2-type zinc-finger protein family