ZIK1_MOUSE Q80YP6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80YP6
Recommended name：Zinc finger protein interacting with ribonucleoprotein K
EC number：
Alternative names：
Cleaved into：
GeneID：22775
Gene names (primary )：Zik1
Gene names (synonym )：
Gene names (ORF )：
Length：463
Mass：52727
Sequence：MTAEMDMALMQGCVTFQDVAICFSHEEWRLLDETQRLLYLSVMLQNFALINSQGCGHKTEDEERRVSTRASKGLRSETTPKTNLCEKCVPILQDILCLPGLPGQKHSTEASSKVDQHQDHNSTGKPLEKNADRSSYLFYLSAKSFPSWDVEKDLPDILSLLKSQVCPKTKKYRKSTEGRKETSHESDKSEECQSLSSQKQTLAHHPKTSNGKKLYECSKCGKTFRGKYSLDQHQRVHTGERPWECRDCGKFFSQTSHLNDHRRIHTGERPYECSECGKLFRQNSSLVDHQKTHTGARPYECSQCGKSFSQKATLVKHKRVHTGERPYKCSECGNSFSQSAILNQHRRIHTGVKPYECRECGKSFSQKATLIKHQRVHTGERPYKCSECGKSFSQSSILIQHRRIHTGARPYECSQCGKSFSQKSGLIQHQVVHTGERPYECDTCGNSFSQCSSLIHHQKCHNA
Tissue specificity：Expressed in ovary and liver, and at lower levels in brain and muscle. {ECO:0000269|PubMed:8910362}.
Induction：
Developmental stage：
Protein families：Krueppel C2H2-type zinc-finger protein family