RAMP1_MOUSE Q9WTJ5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WTJ5
Recommended name：Receptor activity-modifying protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：51801
Gene names (primary )：Ramp1
Gene names (synonym )：
Gene names (ORF )：
Length：148
Mass：16892
Sequence：MAPGLRGLPRCGLWLLLAHHLFMVTACRDPDYGTLIQELCLSRFKENMETIGKTLWCDWGKTIQSYGELTYCTKHVAHTIGCFWPNPEVDRFFIAVHHRYFSKCPISGRALRDPPNSILCPFIALPITVTLLMTALVVWRSKRTEGIV
Tissue specificity：Expressed predominantly in the thymus, skeletal muscle, embryonic and adult brain, embryonic and adult lung, and colon. {ECO:0000269|PubMed:10777702, ECO:0000269|PubMed:10854696, ECO:0000269|PubMed:12147211}.
Induction：
Developmental stage：
Protein families：RAMP family