NMNA3_HUMAN Q96T66
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96T66
Recommended name：Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
EC number：EC:2.7.7.18
Alternative names：(NMN/NaMN adenylyltransferase 3) (Nicotinamide-nucleotide adenylyltransferase 3) (NMN adenylyltransferase 3) (Nicotinate-nucleotide adenylyltransferase 3) (NaMN adenylyltransferase 3) (Pyridine nucleotide adenylyltransferase 3) (PNAT-3)
Cleaved into：
GeneID：349565
Gene names (primary )：NMNAT3
Gene names (synonym )：
Gene names (ORF )：FKSG76
Length：252
Mass：28322
Sequence：MKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS
Tissue specificity：Expressed in lung and spleen with lower levels in placenta and kidney. {ECO:0000269|PubMed:12574164, ECO:0000269|PubMed:16118205}.
Induction：
Developmental stage：
Protein families：Eukaryotic NMN adenylyltransferase family