IP6K2_MOUSE Q80V72
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80V72
Recommended name：Inositol hexakisphosphate kinase 2
EC number：EC 2.7.4.-
Alternative names：(InsP6 kinase 2) (P(i)-uptake stimulator) (PiUS)
Cleaved into：
GeneID：76500
Gene names (primary )：Ip6k2
Gene names (synonym )：Ihpk2
Gene names (ORF )：
Length：448
Mass：51644
Sequence：MSPAFRTMDVEPRTKGILLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRRFTPQYKAVLIFVRCADEFGASGNIETKEQGVVSVRFEEDEDRNLCLIAYPLKGDHGTVDIVDNSDCEPKSKLLRWTNKKHHALETEKNPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYSVEKKGNVSSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGTGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKEWPEVTLDSDAEDLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDSVVHEGQDAGYIFGLQSLIDIVTEISEESGE
Tissue specificity：Highly expressed in brain and lung, and at slightly lower levels in liver, kidney and testis. {ECO:0000269|PubMed:10574768}.
Induction：
Developmental stage：
Protein families：Inositol phosphokinase (IPK) family