PMP22_RAT P25094
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P25094
Recommended name：Peripheral myelin protein 22
EC number：
Alternative names：Protein CD25 SR13 myelin protein Schwann cell membrane glycoprotein (SAG)
Cleaved into：
GeneID：24660
Gene names (primary )：Pmp22
Gene names (synonym )：Cd25, Pmp-22
Gene names (ORF )：
Length：160
Mass：17,946
Sequence：MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE
Tissue specificity：Found exclusively in the peripheral nervous system. Present in both myelinating and nonmyelinating Schwann cells. Found in the tumors of Schwann cell lineage where axons are present (neurofibromas) but not where axons are absent (schwannomas). 1
Induction：Levels increase between embryonic day 21 (21 dpc) and postnatal day 1 (P1) and then gradually increase up to P15. There is a slight increase between P15 and adulthood. 1 Publication
Developmental stage：Strongly down-regulated in the initial phase after sciatic nerve injury.
Protein families：