VSTM4_MOUSE T1NXB5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:T1NXB5
Recommended name：V-set and transmembrane domain-containing protein 4 [Cleaved into: Peptide Lv]
EC number：
Alternative names：
Cleaved into：
GeneID：320736
Gene names (primary )：Vstm4
Gene names (synonym )：
Gene names (ORF )：
Length：319
Mass：35899
Sequence：MRLRLLALAAAVLLGPAPEVCGALNVTVSPGPVVDYLEGENATLLCHVSQKRRKDSLLAVRWFFAPDGSQEALMVKMTKLRIIQYYGNFSRTANQQRLRLLEERRGVLYRLSVLTLRPTDQGQYVCKVQEISKHRNKWTAWSNGSSATEMRVISLKAGEDSSFEKKKVTWAFFEDLYVYAVLVCCVGILSVLLFTLVIAWQSVFHKRKSRVRHYLVKCPQNSSGETVTSVTSLAPLQPQKGKRQKKKVDVPPAVPAKAPIATTFHKPKLLKPQRKVALPKITEENLTYAELELIKPHRAAKGVPTSTVYAQILFEENQL
Tissue specificity：Peptide Lv is widely expressed in various tissues and the central nervous system, including the retinal photoreceptor layer, hippocampus, olfactory bulb, and cerebellum. {ECO:0000269|PubMed:22912796}.
Induction：
Developmental stage：
Protein families：