KAPCA_RAT P27791
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P27791
Recommended name：cAMP-dependent protein kinase catalytic subunit alpha
EC number：EC:2.7.11.11
Alternative names：PKA C-alpha
Cleaved into：
GeneID：
Gene names (primary )：Prkaca
Gene names (synonym )：
Gene names (ORF )：
Length：351
Mass：40,620
Sequence：MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWEDPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF
Tissue specificity：Ubiquitously expressed. Isoform 2 is round spermatid specific. 2 s
Induction：
Developmental stage：In spermatids, isoform 1 is expressed until spermatids become elutriated, whereafter isoform 2 is expressed. 1
Protein families：