RAB3D_MOUSE P35276
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35276
Recommended name：Ras-related protein Rab-3D
EC number：
Alternative names：
Cleaved into：
GeneID：19340
Gene names (primary )：Rab3d
Gene names (synonym )：
Gene names (ORF )：
Length：219
Mass：24416
Sequence：MASASEPPASPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFTAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDIICDKMNESLEPSSSPGSNGKGPALGDTPPPQPSSCSC
Tissue specificity：Predominantly expressed in the adipocyte tissue, but is also expressed in several other organs including skin, spleen, heart and lung.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Rab family